Web Analysis for Nileshprasadlawyermitchellkeil - nileshprasadlawyermitchellkeil.com
This website examines the conduct of Nilesh Prasad, Lawyer and Partner of Mitchell Keil (Law Firm), Suva, Fiji in High Court of Fiji proceedings HBC 123 of 2019
nileshprasadlawyermitchellkeil.com is 3 years 10 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, nileshprasadlawyermitchellkeil.com is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | 4 |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 4 |
Google Adsense: | Not Applicable | Google Analytics: | UA-171146176-1 |
Websites Hosted on Same IP (i.e. 199.34.228.159)
Watch Market Review | India's first-of-its-kind professional bi-monthl
Watch Market Review | India's first-of-its-kind professional bi-monthly business trade journal, watch magazine concerned exclusively with the watch and clock trade and its allied branches
Kid-Eze Therapy Services - Kid-Eze Therapy Services - Home
Paediatric occupational therapy practice based in Olinda in the Dandenong Ranges near Melbourne and dedicated to helping children do more to be more.
PIT BULL RESCUE CENTRAL - Pit Bull Rescue Central
Pit Bull Rescue Central is a virtual shelter for homeless Pit Bulls, Am Staffs and Pit Mixes
HTTP Header Analysis
Date: Tue, 30 Jun 2020 22:44:38 GMT
Server: Apache
Vary: X-W-SSL,Accept-Encoding,User-Agent
Cache-Control: private
ETag: W/"74b57f5db334bcd8aa2376a5eeeb8f7a-gzip"
Content-Encoding: gzip
X-Host: pages10.sf2p.intern.weebly.net
X-UA-Compatible: IE=edge,chrome=1
Content-Length: 7731
Content-Type: text/html; charset=UTF-8
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
dns1.register.com | 162.159.27.248 | United States of America | |
dns2.register.com | 162.159.26.197 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
nileshprasadlawyermitchellkeil.com | A | 3600 |
IP: 199.34.228.159 |
nileshprasadlawyermitchellkeil.com | NS | 3600 |
Target: dns026.c.register.com |
nileshprasadlawyermitchellkeil.com | NS | 3600 |
Target: dns013.a.register.com |
nileshprasadlawyermitchellkeil.com | NS | 3600 |
Target: dns136.b.register.com |
nileshprasadlawyermitchellkeil.com | NS | 3600 |
Target: dns083.d.register.com |
nileshprasadlawyermitchellkeil.com | SOA | 3600 |
MNAME: dns013.a.register.com RNAME: root.register.com Serial: 2020062905 Refresh: 28800 Retry: 7200 Expire: 604800 Minimum TTL: 3600 |
nileshprasadlawyermitchellkeil.com | MX | 3600 |
Priority: 10 Target: alt3.aspmx.l.google.com |
nileshprasadlawyermitchellkeil.com | MX | 3600 |
Priority: 1 Target: aspmx.l.google.com |
nileshprasadlawyermitchellkeil.com | MX | 3600 |
Priority: 5 Target: alt1.aspmx.l.google.com |
nileshprasadlawyermitchellkeil.com | MX | 3600 |
Priority: 5 Target: alt2.aspmx.l.google.com |
nileshprasadlawyermitchellkeil.com | MX | 3600 |
Priority: 10 Target: alt4.aspmx.l.google.com |
nileshprasadlawyermitchellkeil.com | TXT | 3600 |
TXT: google-site-verification=7CrGYFrH_t24DPR goapXvNpeHPW9vxgYvwDZGK-i-pQ |
Full WHOIS Lookup
Registry Domain ID: 2542502979_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.register.com
Registrar URL: http://www.register.com
Updated Date: 2020-06-29T14:15:23Z
Creation Date: 2020-06-29T14:15:23Z
Registrar Registration Expiration Date: 2021-06-29T14:15:23Z
Registrar: Register.com, Inc.
Registrar IANA ID: 9
Reseller:
Domain Status: clientTransferProhibited http://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Statutory Masking Enabled
Registrant Name: Statutory Masking Enabled
Registrant Organization: Statutory Masking Enabled
Registrant Street: Statutory Masking Enabled
Registrant City: Statutory Masking Enabled
Registrant State/Province: Statutory Masking Enabled
Registrant Postal Code: Statutory Masking Enabled
Registrant Country: Statutory Masking Enabled
Registrant Phone: Statutory Masking Enabled
Registrant Phone Ext.: Statutory Masking Enabled
Registrant Fax: Statutory Masking Enabled
Registrant Fax Ext.: Statutory Masking Enabled
Registrant Email: abuse@web.com
Registry Admin ID: Statutory Masking Enabled
Admin Name: Statutory Masking Enabled
Admin Organization: Statutory Masking Enabled
Admin Street: Statutory Masking Enabled
Admin City: Statutory Masking Enabled
Admin State/Province: Statutory Masking Enabled
Admin Postal Code: Statutory Masking Enabled
Admin Country: Statutory Masking Enabled
Admin Phone: Statutory Masking Enabled
Admin Phone Ext.: Statutory Masking Enabled
Admin Fax: Statutory Masking Enabled
Admin Fax Ext.: Statutory Masking Enabled
Admin Email: abuse@web.com
Registry Tech ID: Statutory Masking Enabled
Tech Name: Statutory Masking Enabled
Tech Organization: Statutory Masking Enabled
Tech Street: Statutory Masking Enabled
Tech City: Statutory Masking Enabled
Tech State/Province: Statutory Masking Enabled
Tech Postal Code: Statutory Masking Enabled
Tech Country: Statutory Masking Enabled
Tech Phone: Statutory Masking Enabled
Tech Phone Ext.: Statutory Masking Enabled
Tech Fax: Statutory Masking Enabled
Tech Fax Ext.: Statutory Masking Enabled
Tech Email: abuse@web.com
Name Server: dns2.register.com
Name Server: dns1.register.com
DNSSEC: Unsigned
Registrar Abuse Contact Email: abuse@web.com
Registrar Abuse Contact Phone: +1.8773812449
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-06-30T22:44:42Z <<<
For more information on Whois status codes, please visit https: //www.icann.org/resources/pages/epp-status-codes-2014-06-16-en.
The data in Register.com's WHOIS database is provided to you by
Register.com for information purposes only, that is, to assist you in
obtaining information about or related to a domain name registration
record. Register.com makes this information available "as is," and
does not guarantee its accuracy. By submitting a WHOIS query, you
agree that you will use this data only for lawful purposes and that,
under no circumstances will you use this data to: (1) allow, enable,
or otherwise support the transmission of mass unsolicited, commercial
advertising or solicitations via direct mail, electronic mail, or by
telephone; or (2) enable high volume, automated, electronic processes
that apply to Register.com (or its systems). The compilation,
repackaging, dissemination or other use of this data is expressly
prohibited without the prior written consent of Register.com.
Register.com reserves the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.